Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins) |
Protein Aldehyde oxidoreductase, N-terminal domain [54315] (2 species) |
Species Desulfovibrio gigas [TaxId:879] [54316] (11 PDB entries) Uniprot Q46509 |
Domain d3fc4a1: 3fc4 A:1-80 [209840] Other proteins in same PDB: d3fc4a2, d3fc4a3, d3fc4a4 automated match to d1vlba2 complexed with cl, edo, fes, mg, pcd |
PDB Entry: 3fc4 (more details), 1.79 Å
SCOPe Domain Sequences for d3fc4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fc4a1 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} miqkvitvngieqnlfvdaeallsdvlrqqlgltgvkvgceqgqcgacsvildgkvvrac vtkmkrvadgaqittiegvg
Timeline for d3fc4a1: