SCOPe 2.03: Domain d3faha2: 3fah A:81-193

Lineage for d3faha2 (3fah A:81-193)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
   core: 4 helices, bundle

4. Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families)
   contains 2Fe-2S cluster

5. Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)

6. Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species)

7. Species Desulfovibrio gigas [TaxId:879] [47744] (8 PDB entries)
   Uniprot Q46509

8. Domain d3faha2: 3fah A:81-193 [209837]
   Other proteins in same PDB: d3faha1, d3faha3, d3faha4
   automated match to d1vlba1
   complexed with cl, fes, gol, mg, pcd

Details for d3faha2

PDB Entry: 3fah, 1.72 Å

PDB Description: Glycerol inhibited form of Aldehyde oxidoreductase from Desulfovibrio gigas

PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d3faha2:

Sequence; same for both SEQRES and ATOM records:

>d3faha2 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas [TaxId: 879]}
qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct
gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl

Timeline for d3faha2:

• d3faha2 is new in SCOPe 2.03-stable
  
• d3faha2 appears in SCOPe 2.04
  
• d3faha2 appears in the current release, SCOPe 2.08