Lineage for d3faha2 (3fah A:81-193)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2324036Fold a.56: CO dehydrogenase ISP C-domain like [47740] (1 superfamily)
    core: 4 helices, bundle
  4. 2324037Superfamily a.56.1: CO dehydrogenase ISP C-domain like [47741] (2 families) (S)
    contains 2Fe-2S cluster
  5. 2324038Family a.56.1.1: CO dehydrogenase ISP C-domain like [47742] (7 proteins)
  6. 2324045Protein Aldehyde oxidoreductase, domain 2 [47743] (2 species)
  7. 2324048Species Desulfovibrio gigas [TaxId:879] [47744] (12 PDB entries)
    Uniprot Q46509
  8. 2324055Domain d3faha2: 3fah A:81-193 [209837]
    Other proteins in same PDB: d3faha1, d3faha3, d3faha4
    automated match to d1vlba1
    complexed with cl, fes, gol, mg, pcd

Details for d3faha2

PDB Entry: 3fah (more details), 1.72 Å

PDB Description: Glycerol inhibited form of Aldehyde oxidoreductase from Desulfovibrio gigas
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d3faha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3faha2 a.56.1.1 (A:81-193) Aldehyde oxidoreductase, domain 2 {Desulfovibrio gigas [TaxId: 879]}
qpenlhplqkawvlhggaqcgfcspgfivsakglldtnadpsredvrdwfqkhrnacrct
gykplvdavmdaaavingkkpetdlefkmpadgriwgskyprptavakvtgtl

SCOPe Domain Coordinates for d3faha2:

Click to download the PDB-style file with coordinates for d3faha2.
(The format of our PDB-style files is described here.)

Timeline for d3faha2: