Lineage for d3faha1 (3fah A:1-80)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2933780Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2933988Family d.15.4.2: 2Fe-2S ferredoxin domains from multidomain proteins [54312] (14 proteins)
  6. 2933995Protein Aldehyde oxidoreductase, N-terminal domain [54315] (2 species)
  7. 2933998Species Desulfovibrio gigas [TaxId:879] [54316] (12 PDB entries)
    Uniprot Q46509
  8. 2934002Domain d3faha1: 3fah A:1-80 [209836]
    Other proteins in same PDB: d3faha2, d3faha3, d3faha4
    automated match to d1vlba2
    complexed with cl, fes, gol, mg, pcd

Details for d3faha1

PDB Entry: 3fah (more details), 1.72 Å

PDB Description: Glycerol inhibited form of Aldehyde oxidoreductase from Desulfovibrio gigas
PDB Compounds: (A:) aldehyde oxidoreductase

SCOPe Domain Sequences for d3faha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3faha1 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]}
miqkvitvngieqnlfvdaeallsdvlrqqlgltgvkvgceqgqcgacsvildgkvvrac
vtkmkrvadgaqittiegvg

SCOPe Domain Coordinates for d3faha1:

Click to download the PDB-style file with coordinates for d3faha1.
(The format of our PDB-style files is described here.)

Timeline for d3faha1: