Lineage for d3f9ma1 (3f9m A:12-218)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885061Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)
  8. 2885062Domain d3f9ma1: 3f9m A:12-218 [209833]
    Other proteins in same PDB: d3f9ma3
    automated match to d1bdga1
    complexed with glc, mrk

Details for d3f9ma1

PDB Entry: 3f9m (more details), 1.5 Å

PDB Description: human pancreatic glucokinase in complex with glucose and activator showing a mobile flap
PDB Compounds: (A:) Glucokinase

SCOPe Domain Sequences for d3f9ma1:

Sequence, based on SEQRES records: (download)

>d3f9ma1 c.55.1.0 (A:12-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkekveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsev
gdflsldlggtnfrvmlvkvgegeegqwsvktkhqmysipedamtgtaemlfdyisecis
dfldkhqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikr
rgdfemdvvamvndtvatmiscyyedh

Sequence, based on observed residues (ATOM records): (download)

>d3f9ma1 c.55.1.0 (A:12-218) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kkekveqilaefqlqeedlkkvmrrmqkemdrglrletheeasvkmlptyvrstpegsev
gdflsldlggtnfrvmlvkvgeqwsvktkhqmysipedamtgtaemlfdyisecisdfld
khqmkhkklplgftfsfpvrhedidkgillnwtkgfkasgaegnnvvgllrdaikrrgdf
emdvvamvndtvatmiscyyedh

SCOPe Domain Coordinates for d3f9ma1:

Click to download the PDB-style file with coordinates for d3f9ma1.
(The format of our PDB-style files is described here.)

Timeline for d3f9ma1: