SCOPe 2.04: Domain d3f8fa_: 3f8f A:

Lineage for d3f8fa_ (3f8f A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (52 species)
   not a true protein

7. Species Lactococcus lactis [TaxId:416870] [188710] (3 PDB entries)

8. Domain d3f8fa_: 3f8f A: [209824]
   automated match to d3f8ca_
   complexed with dm1

Details for d3f8fa_

PDB Entry: 3f8f, 2.2 Å

PDB Description: Crystal structure of multidrug binding transcriptional regulator LmrR complexed with Daunomycin

PDB Compounds: (A:) Transcriptional regulator, PadR-like family

SCOPe Domain Sequences for d3f8fa_:

Sequence, based on SEQRES records:

>d3f8fa_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]}
maeipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekd
giissywgdesqggrrkyyrlteighenmrlafeswsrvdkiienleankkseaik

Sequence, based on observed residues (ATOM records):

>d3f8fa_ a.4.5.0 (A:) automated matches {Lactococcus lactis [TaxId: 416870]}
maeipkemlraqtnvillnvlkqgdnyvygiikqvkeasngemelneatlytifkrlekd
giissywgdeggrrkyyrlteighenmrlafeswsrvdkiienleankkseaik

Timeline for d3f8fa_:

• d3f8fa_ first appeared in SCOPe 2.03
  
• d3f8fa_ appears in SCOPe 2.05
  
• d3f8fa_ appears in the current release, SCOPe 2.08