Lineage for d3f7pb2 (3f7p B:181-290)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712101Family a.40.1.0: automated matches [227151] (1 protein)
    not a true family
  6. 2712102Protein automated matches [226856] (4 species)
    not a true protein
  7. 2712108Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)
  8. 2712160Domain d3f7pb2: 3f7p B:181-290 [209823]
    Other proteins in same PDB: d3f7pa1, d3f7pb1, d3f7pc1, d3f7pc2, d3f7pd1, d3f7pd2
    automated match to d1sh5a2
    complexed with ca, edo, peg

Details for d3f7pb2

PDB Entry: 3f7p (more details), 2.75 Å

PDB Description: Crystal structure of a complex between integrin beta4 and plectin
PDB Compounds: (B:) Plectin-1

SCOPe Domain Sequences for d3f7pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f7pb2 a.40.1.0 (B:181-290) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsedmtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhkpllidmnkvyrq
tnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamp

SCOPe Domain Coordinates for d3f7pb2:

Click to download the PDB-style file with coordinates for d3f7pb2.
(The format of our PDB-style files is described here.)

Timeline for d3f7pb2: