Class a: All alpha proteins [46456] (284 folds) |
Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) |
Family a.40.1.0: automated matches [227151] (1 protein) not a true family |
Protein automated matches [226856] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [224978] (13 PDB entries) |
Domain d3f7pa2: 3f7p A:181-290 [209821] Other proteins in same PDB: d3f7pa1, d3f7pb1 automated match to d1sh5a2 complexed with ca, edo, peg |
PDB Entry: 3f7p (more details), 2.75 Å
SCOPe Domain Sequences for d3f7pa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f7pa2 a.40.1.0 (A:181-290) automated matches {Human (Homo sapiens) [TaxId: 9606]} qsedmtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhkpllidmnkvyrq tnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamp
Timeline for d3f7pa2: