SCOPe 2.08: Domain d3f7pa2: 3f7p A:181-290

Lineage for d3f7pa2 (3f7p A:181-290)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.0: automated matches [227151] (1 protein)
   not a true family

6. Protein automated matches [226856] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224978] (33 PDB entries)

8. Domain d3f7pa2: 3f7p A:181-290 [209821]
   Other proteins in same PDB: d3f7pa1, d3f7pb1, d3f7pc1, d3f7pc2, d3f7pd1, d3f7pd2
   automated match to d1sh5a2
   complexed with ca, edo, peg

Details for d3f7pa2

PDB Entry: 3f7p, 2.75 Å

PDB Description: Crystal structure of a complex between integrin beta4 and plectin

PDB Compounds: (A:) Plectin-1

SCOPe Domain Sequences for d3f7pa2:

Sequence; same for both SEQRES and ATOM records:

>d3f7pa2 a.40.1.0 (A:181-290) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qsedmtakeklllwsqrmvegyqglrcdnftsswrdgrlfnaiihrhkpllidmnkvyrq
tnlenldqafsvaerdlgvtrlldpedvdvpqpdeksiityvsslydamp

Timeline for d3f7pa2:

• d3f7pa2 first appeared in SCOPe 2.03
  
• d3f7pa2 appears in SCOPe 2.07