SCOPe 2.03: Domain d3f7pa1: 3f7p A:60-180

Lineage for d3f7pa1 (3f7p A:60-180)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.40: CH domain-like [47575] (3 superfamilies)
   core: 4 helices: bundle

4. Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families)

5. Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
   Pfam PF00307

6. Protein automated matches [191021] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188812] (2 PDB entries)

8. Domain d3f7pa1: 3f7p A:60-180 [209820]
   Other proteins in same PDB: d3f7pa2, d3f7pb2
   automated match to d1sh5a1
   complexed with ca, edo, peg

Details for d3f7pa1

PDB Entry: 3f7p, 2.75 Å

PDB Description: Crystal structure of a complex between integrin beta4 and plectin

PDB Compounds: (A:) Plectin-1

SCOPe Domain Sequences for d3f7pa1:

Sequence; same for both SEQRES and ATOM records:

>d3f7pa1 a.40.1.1 (A:60-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
viriaderdrvqkktftkwvnkhlikaqrhisdlyedlrdghnlisllevlsgdslprek
grmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiqvs
g

Timeline for d3f7pa1:

• d3f7pa1 is new in SCOPe 2.03-stable
  
• d3f7pa1 appears in SCOPe 2.04
  
• d3f7pa1 appears in the current release, SCOPe 2.08