![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.40: CH domain-like [47575] (3 superfamilies) core: 4 helices: bundle |
![]() | Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) ![]() |
![]() | Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins) Pfam PF00307 |
![]() | Protein automated matches [191021] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188812] (7 PDB entries) |
![]() | Domain d3f7pa1: 3f7p A:60-180 [209820] Other proteins in same PDB: d3f7pa2, d3f7pb2, d3f7pc1, d3f7pc2, d3f7pd1, d3f7pd2 automated match to d1sh5a1 complexed with ca, edo, peg |
PDB Entry: 3f7p (more details), 2.75 Å
SCOPe Domain Sequences for d3f7pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f7pa1 a.40.1.1 (A:60-180) automated matches {Human (Homo sapiens) [TaxId: 9606]} viriaderdrvqkktftkwvnkhlikaqrhisdlyedlrdghnlisllevlsgdslprek grmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiqvs g
Timeline for d3f7pa1: