Lineage for d3f7pa1 (3f7p A:60-180)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712022Fold a.40: CH domain-like [47575] (3 superfamilies)
    core: 4 helices: bundle
  4. 2712023Superfamily a.40.1: Calponin-homology domain, CH-domain [47576] (2 families) (S)
  5. 2712024Family a.40.1.1: Calponin-homology domain, CH-domain [47577] (10 proteins)
    Pfam PF00307
  6. 2712088Protein automated matches [191021] (2 species)
    not a true protein
  7. 2712089Species Human (Homo sapiens) [TaxId:9606] [188812] (7 PDB entries)
  8. 2712094Domain d3f7pa1: 3f7p A:60-180 [209820]
    Other proteins in same PDB: d3f7pa2, d3f7pb2, d3f7pc1, d3f7pc2, d3f7pd1, d3f7pd2
    automated match to d1sh5a1
    complexed with ca, edo, peg

Details for d3f7pa1

PDB Entry: 3f7p (more details), 2.75 Å

PDB Description: Crystal structure of a complex between integrin beta4 and plectin
PDB Compounds: (A:) Plectin-1

SCOPe Domain Sequences for d3f7pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f7pa1 a.40.1.1 (A:60-180) automated matches {Human (Homo sapiens) [TaxId: 9606]}
viriaderdrvqkktftkwvnkhlikaqrhisdlyedlrdghnlisllevlsgdslprek
grmrfhklqnvqialdylrhrqvklvnirnddiadgnpkltlgliwtiilhfqisdiqvs
g

SCOPe Domain Coordinates for d3f7pa1:

Click to download the PDB-style file with coordinates for d3f7pa1.
(The format of our PDB-style files is described here.)

Timeline for d3f7pa1: