Lineage for d1maml2 (1mam L:109-214)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453918Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 454044Species Mouse (Mus musculus) [TaxId:10090] [88567] (277 PDB entries)
  8. 454252Domain d1maml2: 1mam L:109-214 [20982]
    Other proteins in same PDB: d1mamh1, d1mamh2, d1maml1
    part of Fab Yst9.1

Details for d1maml2

PDB Entry: 1mam (more details), 2.45 Å

PDB Description: crystal structure to 2.45 a resolution of a monoclonal fab specific for the brucella a cell wall polysaccharide antigen

SCOP Domain Sequences for d1maml2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1maml2 b.1.1.2 (L:109-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1maml2:

Click to download the PDB-style file with coordinates for d1maml2.
(The format of our PDB-style files is described here.)

Timeline for d1maml2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1maml1