SCOPe 2.03: Domain d3f6fa2: 3f6f A:86-209

Lineage for d3f6fa2 (3f6f A:86-209)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (36 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (4 PDB entries)

8. Domain d3f6fa2: 3f6f A:86-209 [209813]
   Other proteins in same PDB: d3f6fa1
   automated match to d1jlva1

Details for d3f6fa2

PDB Entry: 3f6f, 1.6 Å

PDB Description: crystal structure of glutathione transferase dmgstd10 from drosophila melanogaster

PDB Compounds: (A:) CG18548-PA (IP02196p) (IP02193p)

SCOPe Domain Sequences for d3f6fa2:

Sequence; same for both SEQRES and ATOM records:

>d3f6fa2 a.45.1.0 (A:86-209) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kdvqkqalinqrlyfdmgtlyksfseyyypqiflkkpaneenykkievafeflntflegq
tysaggdysladiaflatvstfdvagfdfkryanvarwyenakkltpgweenwagcqefr
kyfd

Timeline for d3f6fa2:

• d3f6fa2 is new in SCOPe 2.03-stable
  
• d3f6fa2 appears in SCOPe 2.04
  
• d3f6fa2 appears in the current release, SCOPe 2.08