Lineage for d3f6fa2 (3f6f A:86-209)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1270513Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1270514Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1271284Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 1271285Protein automated matches [226831] (36 species)
    not a true protein
  7. 1271389Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225709] (4 PDB entries)
  8. 1271391Domain d3f6fa2: 3f6f A:86-209 [209813]
    Other proteins in same PDB: d3f6fa1
    automated match to d1jlva1

Details for d3f6fa2

PDB Entry: 3f6f (more details), 1.6 Å

PDB Description: crystal structure of glutathione transferase dmgstd10 from drosophila melanogaster
PDB Compounds: (A:) CG18548-PA (IP02196p) (IP02193p)

SCOPe Domain Sequences for d3f6fa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f6fa2 a.45.1.0 (A:86-209) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
kdvqkqalinqrlyfdmgtlyksfseyyypqiflkkpaneenykkievafeflntflegq
tysaggdysladiaflatvstfdvagfdfkryanvarwyenakkltpgweenwagcqefr
kyfd

SCOPe Domain Coordinates for d3f6fa2:

Click to download the PDB-style file with coordinates for d3f6fa2.
(The format of our PDB-style files is described here.)

Timeline for d3f6fa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f6fa1