Lineage for d3f6fa1 (3f6f A:1-85)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879500Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [225708] (18 PDB entries)
  8. 2879521Domain d3f6fa1: 3f6f A:1-85 [209812]
    Other proteins in same PDB: d3f6fa2
    automated match to d1jlva2

Details for d3f6fa1

PDB Entry: 3f6f (more details), 1.6 Å

PDB Description: crystal structure of glutathione transferase dmgstd10 from drosophila melanogaster
PDB Compounds: (A:) CG18548-PA (IP02196p) (IP02193p)

SCOPe Domain Sequences for d3f6fa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f6fa1 c.47.1.0 (A:1-85) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mdlyyrpgsapcrsvlmtakalgvefdkktiintrareqftpeylkinpqhtiptlhdhg
falwesraimvylvekygkddklfp

SCOPe Domain Coordinates for d3f6fa1:

Click to download the PDB-style file with coordinates for d3f6fa1.
(The format of our PDB-style files is described here.)

Timeline for d3f6fa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f6fa2