Lineage for d3f6db1 (3f6d B:1-90)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879030Species Anopheles dirus [TaxId:7168] [226778] (2 PDB entries)
  8. 2879032Domain d3f6db1: 3f6d B:1-90 [209810]
    Other proteins in same PDB: d3f6da2, d3f6db2
    automated match to d1r5aa2
    complexed with gtx

Details for d3f6db1

PDB Entry: 3f6d (more details), 1.7 Å

PDB Description: crystal structure of a genetically modified delta class gst (adgstd4- 4) from anopheles dirus, f123a, in complex with s-hexyl glutathione
PDB Compounds: (B:) glutathione transferase GST1-4

SCOPe Domain Sequences for d3f6db1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f6db1 c.47.1.0 (B:1-90) automated matches {Anopheles dirus [TaxId: 7168]}
mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
fvlwesraiqiylvekygahdadlaerlyp

SCOPe Domain Coordinates for d3f6db1:

Click to download the PDB-style file with coordinates for d3f6db1.
(The format of our PDB-style files is described here.)

Timeline for d3f6db1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f6db2