SCOPe 2.08: Domain d3f6da2: 3f6d A:91-218

Lineage for d3f6da2 (3f6d A:91-218)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Anopheles dirus [TaxId:7168] [226779] (2 PDB entries)

8. Domain d3f6da2: 3f6d A:91-218 [209809]
   Other proteins in same PDB: d3f6da1, d3f6db1
   automated match to d1r5aa1
   complexed with gtx

Details for d3f6da2

PDB Entry: 3f6d, 1.7 Å

PDB Description: crystal structure of a genetically modified delta class gst (adgstd4- 4) from anopheles dirus, f123a, in complex with s-hexyl glutathione

PDB Compounds: (A:) glutathione transferase GST1-4

SCOPe Domain Sequences for d3f6da2:

Sequence; same for both SEQRES and ATOM records:

>d3f6da2 a.45.1.0 (A:91-218) automated matches {Anopheles dirus [TaxId: 7168]}
sdprrravvhqrlffdvavlyqrfaeyyypqiagqkvpvgdpgrlrsmeqaleflntfle
geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak
vfgryftq

Timeline for d3f6da2:

• d3f6da2 first appeared in SCOPe 2.03
  
• d3f6da2 appears in SCOPe 2.07