Lineage for d3f63b2 (3f63 B:91-216)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1491777Protein Class delta GST [81355] (6 species)
    formerly a part of class theta enzymes
  7. 1491781Species Anopheles dirus [TaxId:7168] [224848] (2 PDB entries)
  8. 1491783Domain d3f63b2: 3f63 B:91-216 [209805]
    Other proteins in same PDB: d3f63a1, d3f63b1
    automated match to d1jlwa1
    complexed with gtx

Details for d3f63b2

PDB Entry: 3f63 (more details), 1.8 Å

PDB Description: Crystal structure of a Delta class GST (adGSTD4-4) from Anopheles dirus, in complex with S-hexyl glutathione
PDB Compounds: (B:) glutathione transferase GST1-4

SCOPe Domain Sequences for d3f63b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f63b2 a.45.1.1 (B:91-216) Class delta GST {Anopheles dirus [TaxId: 7168]}
sdprrravvhqrlffdvavlyqrfaeyyypqifgqkvpvgdpgrlrsmeqaleflntfle
geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak
vfgryf

SCOPe Domain Coordinates for d3f63b2:

Click to download the PDB-style file with coordinates for d3f63b2.
(The format of our PDB-style files is described here.)

Timeline for d3f63b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f63b1