SCOPe 2.07: Domain d3f63b2: 3f63 B:91-216

Lineage for d3f63b2 (3f63 B:91-216)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 protein domains)

6. Protein Class delta GST [81355] (6 species)
   formerly a part of class theta enzymes

7. Species Anopheles dirus [TaxId:7168] [224848] (2 PDB entries)

8. Domain d3f63b2: 3f63 B:91-216 [209805]
   Other proteins in same PDB: d3f63a1, d3f63b1
   automated match to d1jlwa1
   complexed with gtx

Details for d3f63b2

PDB Entry: 3f63, 1.8 Å

PDB Description: Crystal structure of a Delta class GST (adGSTD4-4) from Anopheles dirus, in complex with S-hexyl glutathione

PDB Compounds: (B:) glutathione transferase GST1-4

SCOPe Domain Sequences for d3f63b2:

Sequence; same for both SEQRES and ATOM records:

>d3f63b2 a.45.1.1 (B:91-216) Class delta GST {Anopheles dirus [TaxId: 7168]}
sdprrravvhqrlffdvavlyqrfaeyyypqifgqkvpvgdpgrlrsmeqaleflntfle
geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak
vfgryf

Timeline for d3f63b2:

• d3f63b2 first appeared in SCOPe 2.03
  
• d3f63b2 appears in SCOPe 2.06