| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins) |
| Protein Class delta GST [81366] (6 species) formerly a part of class theta enzymes |
| Species Anopheles dirus [TaxId:7168] [224892] (2 PDB entries) |
| Domain d3f63b1: 3f63 B:1-90 [209804] Other proteins in same PDB: d3f63a2, d3f63b2 automated match to d1jlwa2 complexed with gtx |
PDB Entry: 3f63 (more details), 1.8 Å
SCOPe Domain Sequences for d3f63b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f63b1 c.47.1.5 (B:1-90) Class delta GST {Anopheles dirus [TaxId: 7168]}
mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
fvlwesraiqiylvekygahdadlaerlyp
Timeline for d3f63b1: