| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
| Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
| Protein Class delta GST [81355] (6 species) formerly a part of class theta enzymes |
| Species Anopheles dirus [TaxId:7168] [224848] (2 PDB entries) |
| Domain d3f63a2: 3f63 A:91-218 [209803] Other proteins in same PDB: d3f63a1, d3f63b1 automated match to d1jlwa1 complexed with gtx |
PDB Entry: 3f63 (more details), 1.8 Å
SCOPe Domain Sequences for d3f63a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f63a2 a.45.1.1 (A:91-218) Class delta GST {Anopheles dirus [TaxId: 7168]}
sdprrravvhqrlffdvavlyqrfaeyyypqifgqkvpvgdpgrlrsmeqaleflntfle
geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak
vfgryftq
Timeline for d3f63a2: