SCOPe 2.05: Domain d3f63a1: 3f63 A:1-90

Lineage for d3f63a1 (3f63 A:1-90)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class delta GST [81366] (6 species)
   formerly a part of class theta enzymes

7. Species Anopheles dirus [TaxId:7168] [224892] (2 PDB entries)

8. Domain d3f63a1: 3f63 A:1-90 [209802]
   Other proteins in same PDB: d3f63a2, d3f63b2
   automated match to d1jlwa2
   complexed with gtx

Details for d3f63a1

PDB Entry: 3f63, 1.8 Å

PDB Description: Crystal structure of a Delta class GST (adGSTD4-4) from Anopheles dirus, in complex with S-hexyl glutathione

PDB Compounds: (A:) glutathione transferase GST1-4

SCOPe Domain Sequences for d3f63a1:

Sequence; same for both SEQRES and ATOM records:

>d3f63a1 c.47.1.5 (A:1-90) Class delta GST {Anopheles dirus [TaxId: 7168]}
mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
fvlwesraiqiylvekygahdadlaerlyp

Timeline for d3f63a1:

• d3f63a1 first appeared in SCOPe 2.03
  
• d3f63a1 appears in SCOPe 2.04
  
• d3f63a1 appears in SCOPe 2.06
  
• d3f63a1 appears in the current release, SCOPe 2.08