Lineage for d3f63a1 (3f63 A:1-90)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2876786Protein Class delta GST [81366] (6 species)
    formerly a part of class theta enzymes
  7. 2876790Species Anopheles dirus [TaxId:7168] [224892] (2 PDB entries)
  8. 2876791Domain d3f63a1: 3f63 A:1-90 [209802]
    Other proteins in same PDB: d3f63a2, d3f63b2
    automated match to d1jlwa2
    complexed with gtx

Details for d3f63a1

PDB Entry: 3f63 (more details), 1.8 Å

PDB Description: Crystal structure of a Delta class GST (adGSTD4-4) from Anopheles dirus, in complex with S-hexyl glutathione
PDB Compounds: (A:) glutathione transferase GST1-4

SCOPe Domain Sequences for d3f63a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f63a1 c.47.1.5 (A:1-90) Class delta GST {Anopheles dirus [TaxId: 7168]}
mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
fvlwesraiqiylvekygahdadlaerlyp

SCOPe Domain Coordinates for d3f63a1:

Click to download the PDB-style file with coordinates for d3f63a1.
(The format of our PDB-style files is described here.)

Timeline for d3f63a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f63a2