Lineage for d3f61a_ (3f61 A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1671717Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1671718Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1671838Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1673984Protein automated matches [190091] (13 species)
    not a true protein
  7. 1674797Species Mycobacterium tuberculosis [TaxId:1773] [225570] (2 PDB entries)
  8. 1674798Domain d3f61a_: 3f61 A: [209801]
    automated match to d1mrub_
    complexed with adp, mg; mutant

Details for d3f61a_

PDB Entry: 3f61 (more details), 1.8 Å

PDB Description: crystal structure of m. tuberculosis pknb leu33asp/val222asp double mutant in complex with adp
PDB Compounds: (A:) serine/threonine-protein kinase pknb

SCOPe Domain Sequences for d3f61a_:

Sequence, based on SEQRES records: (download)

>d3f61a_ d.144.1.7 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mttpshlsdryelgeilgfggmsevhlardlrdhrdvavkvlradlardpsfylrfrrea
qnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraievia
dacqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavigta
qylspeqargdsvdarsdvyslgcvlyevltgeppftgdspdsvayqhvredpippsarh
eglsadldavvlkalaknpenryqtaaemradlvrvhngeppeapkvltd

Sequence, based on observed residues (ATOM records): (download)

>d3f61a_ d.144.1.7 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mttpshlsdryelgeilgfggmsevhlardlrdhrdvavkvlradlardpsfylrfrrea
qnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraievia
dacqalnfshqngiihrdvkpanimisatnavkvmdfgiaaqylspeqargdsvdarsdv
yslgcvlyevltgeppftgdspdsvayqhvredpippsarheglsadldavvlkalaknp
enryqtaaemradlvrvhngeppeapkvltd

SCOPe Domain Coordinates for d3f61a_:

Click to download the PDB-style file with coordinates for d3f61a_.
(The format of our PDB-style files is described here.)

Timeline for d3f61a_: