SCOP 1.63: Domain d1acyl2: 1acy L:109-211

Lineage for d1acyl2 (1acy L:109-211)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab 59.1 (mouse), kappa L chain [48994] (2 PDB entries)

8. Domain d1acyl2: 1acy L:109-211 [20980]
   Other proteins in same PDB: d1acyh1, d1acyl1

Details for d1acyl2

PDB Entry: 1acy, 3 Å

PDB Description: crystal structure of the principal neutralizing site of hiv-1

SCOP Domain Sequences for d1acyl2:

Sequence; same for both SEQRES and ATOM records:

>d1acyl2 b.1.1.2 (L:109-211) Immunoglobulin (constant domains of L and H chains) {Fab 59.1 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1acyl2:

• d1acyl2 first appeared (with stable ids) in SCOP 1.55
  
• d1acyl2 appears in SCOP 1.61
  
• d1acyl2 appears in SCOP 1.65
  
• d1acyl2 appears in the current release, SCOPe 2.08