![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
![]() | Species Fab 59.1 (mouse), kappa L chain [48994] (2 PDB entries) |
![]() | Domain d1ai1h2: 1ai1 H:113-226 [20979] Other proteins in same PDB: d1ai1h1, d1ai1l1 |
PDB Entry: 1ai1 (more details), 2.8 Å
SCOP Domain Sequences for d1ai1h2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ai1h2 b.1.1.2 (H:113-226) Immunoglobulin (constant domains of L and H chains) {Fab 59.1 (mouse), kappa L chain} sakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqs dlytlsssvtvpssprpsetvtcnvahpasstkvdkkivpr
Timeline for d1ai1h2: