![]() | Class a: All alpha proteins [46456] (285 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.11: HMD dimerization domain-like [140777] (1 protein) dimer similar to those of the GDP-mannose 6-dehydrogenase and class I KARI domains automatically mapped to Pfam PF03201 |
![]() | Protein 5,10-methenyltetrahydromethanopterin hydrogenase, HMD [140778] (1 species) |
![]() | Species Methanocaldococcus jannaschii [TaxId:2190] [140779] (6 PDB entries) Uniprot Q58194 243-344 |
![]() | Domain d3f47a2: 3f47 A:243-344 [209789] Other proteins in same PDB: d3f47a1 automated match to d2b0ja1 complexed with cmo, fe2, i2c, na |
PDB Entry: 3f47 (more details), 1.75 Å
SCOPe Domain Sequences for d3f47a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f47a2 a.100.1.11 (A:243-344) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Methanocaldococcus jannaschii [TaxId: 2190]} anligpvcdmcsavtatvyagllayrdavtkilgapadfaqmmadealtqihnlmkekgi anmeealdpaallgtadsmcfgplaeilptalkvlekhkvve
Timeline for d3f47a2: