Lineage for d3f47a1 (3f47 A:1-242)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1346342Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1346343Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1349311Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 1349312Protein 5,10-methenyltetrahydromethanopterin hydrogenase, HMD [141932] (1 species)
  7. 1349313Species Methanocaldococcus jannaschii [TaxId:2190] [141933] (4 PDB entries)
    Uniprot Q58194 1-242
  8. 1349314Domain d3f47a1: 3f47 A:1-242 [209788]
    Other proteins in same PDB: d3f47a2
    automated match to d2b0ja2
    complexed with cmo, fe2, i2c, na

Details for d3f47a1

PDB Entry: 3f47 (more details), 1.75 Å

PDB Description: the crystal structure of [fe]-hydrogenase (hmd) holoenzyme from methanocaldococcus jannaschii
PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d3f47a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f47a1 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Methanocaldococcus jannaschii [TaxId: 2190]}
mkiailgagcyrthaaagitnfmracevakevgkpeialthssitygaellhlvpdvkev
ivsdpcfaeepglvvidefdpkevmeahlsgnpesimpkirevvkakakelpkppkacih
lvhpedvglkvtsddreavegadivitwlpkgnkqpdiikkfadaipegaivthactipt
tkfakifkdlgredlnitsyhpgcvpemkgqvyiaegyaseeavnklyeigkiargkafk
mp

SCOPe Domain Coordinates for d3f47a1:

Click to download the PDB-style file with coordinates for d3f47a1.
(The format of our PDB-style files is described here.)

Timeline for d3f47a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3f47a2