SCOPe 2.03: Domain d3f47a1: 3f47 A:1-242

Lineage for d3f47a1 (3f47 A:1-242)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (19 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein 5,10-methenyltetrahydromethanopterin hydrogenase, HMD [141932] (1 species)

7. Species Methanocaldococcus jannaschii [TaxId:2190] [141933] (4 PDB entries)
   Uniprot Q58194 1-242

8. Domain d3f47a1: 3f47 A:1-242 [209788]
   Other proteins in same PDB: d3f47a2
   automated match to d2b0ja2
   complexed with cmo, fe2, i2c, na

Details for d3f47a1

PDB Entry: 3f47, 1.75 Å

PDB Description: the crystal structure of [fe]-hydrogenase (hmd) holoenzyme from methanocaldococcus jannaschii

PDB Compounds: (A:) 5,10-methenyltetrahydromethanopterin hydrogenase

SCOPe Domain Sequences for d3f47a1:

Sequence; same for both SEQRES and ATOM records:

>d3f47a1 c.2.1.6 (A:1-242) 5,10-methenyltetrahydromethanopterin hydrogenase, HMD {Methanocaldococcus jannaschii [TaxId: 2190]}
mkiailgagcyrthaaagitnfmracevakevgkpeialthssitygaellhlvpdvkev
ivsdpcfaeepglvvidefdpkevmeahlsgnpesimpkirevvkakakelpkppkacih
lvhpedvglkvtsddreavegadivitwlpkgnkqpdiikkfadaipegaivthactipt
tkfakifkdlgredlnitsyhpgcvpemkgqvyiaegyaseeavnklyeigkiargkafk
mp

Timeline for d3f47a1:

• d3f47a1 is new in SCOPe 2.03-stable
  
• d3f47a1 appears in SCOPe 2.04
  
• d3f47a1 appears in the current release, SCOPe 2.08