SCOP 1.63: Domain d1ai1l2: 1ai1 L:109-211

Lineage for d1ai1l2 (1ai1 L:109-211)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)

7. Species Fab 59.1 (mouse), kappa L chain [48994] (2 PDB entries)

8. Domain d1ai1l2: 1ai1 L:109-211 [20978]
   Other proteins in same PDB: d1ai1h1, d1ai1l1

Details for d1ai1l2

PDB Entry: 1ai1, 2.8 Å

PDB Description: hiv-1 v3 loop mimic

SCOP Domain Sequences for d1ai1l2:

Sequence; same for both SEQRES and ATOM records:

>d1ai1l2 b.1.1.2 (L:109-211) Immunoglobulin (constant domains of L and H chains) {Fab 59.1 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

Timeline for d1ai1l2:

• d1ai1l2 first appeared (with stable ids) in SCOP 1.55
  
• d1ai1l2 appears in SCOP 1.61
  
• d1ai1l2 appears in SCOP 1.65
  
• d1ai1l2 appears in the current release, SCOPe 2.08