SCOPe 2.04: Domain d3f12a2: 3f12 A:110-212

Lineage for d3f12a2 (3f12 A:110-212)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d3f12a2: 3f12 A:110-212 [209769]
   Other proteins in same PDB: d3f12a1, d3f12c1
   automated match to d1rhha2

Details for d3f12a2

PDB Entry: 3f12, 2.95 Å

PDB Description: Germline V-genes sculpt the binding site of a family of antibodies neutralizing human cytomegalovirus

PDB Compounds: (A:) M2J1 Fab

SCOPe Domain Sequences for d3f12a2:

Sequence; same for both SEQRES and ATOM records:

>d3f12a2 b.1.1.2 (A:110-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d3f12a2:

• d3f12a2 first appeared in SCOPe 2.03
  
• d3f12a2 appears in SCOPe 2.05
  
• d3f12a2 appears in the current release, SCOPe 2.08