| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
| Family a.4.5.79: MerB N-terminal domain-like [158323] (1 protein) |
| Protein Alkylmercury lyase MerB [158324] (1 species) |
| Species Escherichia coli [TaxId:562] [158325] (17 PDB entries) Uniprot P77072 21-80 |
| Domain d3f0pb1: 3f0p B:1-80 [209765] Other proteins in same PDB: d3f0pa2, d3f0pb2 automated match to d1s6la1 complexed with br, hg |
PDB Entry: 3f0p (more details), 1.64 Å
SCOPe Domain Sequences for d3f0pb1:
Sequence, based on SEQRES records: (download)
>d3f0pb1 a.4.5.79 (B:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
mklapyilelltsvnrtngtadllvpllrelakgrpvsrttlagildwpaervaavleqa
tsteydkdgniigygltlre
>d3f0pb1 a.4.5.79 (B:1-80) Alkylmercury lyase MerB {Escherichia coli [TaxId: 562]}
mklapyilelltgtadllvpllrelakgrpvsrttlagildwpaervaavleqatsteyd
kdgniigygltlre
Timeline for d3f0pb1: