SCOPe 2.04: Domain d3f0nb1: 3f0n B:7-193

Lineage for d3f0nb1 (3f0n B:7-193)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (16 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [225562] (1 PDB entry)

8. Domain d3f0nb1: 3f0n B:7-193 [209757]
   Other proteins in same PDB: d3f0na2, d3f0nb2
   automated match to d1fi4a1
   complexed with po4

Details for d3f0nb1

PDB Entry: 3f0n, 1.9 Å

PDB Description: mus musculus mevalonate pyrophosphate decarboxylase

PDB Compounds: (B:) mevalonate pyrophosphate decarboxylase

SCOPe Domain Sequences for d3f0nb1:

Sequence, based on SEQRES records:

>d3f0nb1 d.14.1.0 (B:7-193) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlmvtctapvniavikywgkrdealilpinsslsvtlhqdqlkttttvaiskdftedriw
lngreedvgqprlqaclreirrlarkrrstedgdtlplslsykvhvasvnnfptaaglas
saagyaclaytlaqvygvegdlsevarrgsgsacrslyggfvewqmgeqadgkdsiarqi
apewhwp

Sequence, based on observed residues (ATOM records):

>d3f0nb1 d.14.1.0 (B:7-193) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlmvtctapvniavikywgkrdealilpinsslsvtlhqdqlkttttvaiskdftedriw
lngreedvgqprlqaclreirrlarkrrlslsykvhvasvnnfpassaagyaclaytlaq
vygvegdlsevarrgsgsacrslyggfvewqmgeqadgkdsiarqiapewhwp

Timeline for d3f0nb1:

• d3f0nb1 first appeared in SCOPe 2.03
  
• d3f0nb1 appears in SCOPe 2.05
  
• d3f0nb1 appears in the current release, SCOPe 2.08