Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) common fold is elaborated with additional secondary structures |
Family d.58.26.0: automated matches [227186] (1 protein) not a true family |
Protein automated matches [226908] (3 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [225563] (1 PDB entry) |
Domain d3f0na2: 3f0n A:194-397 [209756] Other proteins in same PDB: d3f0na1, d3f0nb1 automated match to d1fi4a2 complexed with po4 |
PDB Entry: 3f0n (more details), 1.9 Å
SCOPe Domain Sequences for d3f0na2:
Sequence, based on SEQRES records: (download)
>d3f0na2 d.58.26.0 (A:194-397) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qlrililvvsadkkqtgstvgmqtsvetstllkfraesvvpermkemtrciqeqdfqgfa qltmkdsnqfhatcldtfppisylndtsrriiqlvhrfnthhgqtkvaytfdagpnavif tledtvaefvaavrhsfppaangdkflkglqvapvllsdelkaalvvepspggvqyiiat qvgpgpqvlddthdhllgqdglpq
>d3f0na2 d.58.26.0 (A:194-397) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qlrililvvsadkqtgstvgmqtsvetstllkfraesvvpermkemtrciqeqdfqgfaq ltmkdsnqfhatcldtfppisylndtsrriiqlvhrfnthhgqtkvaytfdagpnavift ledtvaefvaavrhsfppaankflkglqvapvllsdelkaalvvepspggvqyiiatqvg pgpqvlddthdhllgqdglpq
Timeline for d3f0na2: