Lineage for d3f0ha_ (3f0h A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867570Species Eubacterium rectale [225558] (1 PDB entry)
  8. 1867571Domain d3f0ha_: 3f0h A: [209752]
    automated match to d2bkwa1
    complexed with gol, unl

Details for d3f0ha_

PDB Entry: 3f0h (more details), 1.7 Å

PDB Description: crystal structure of aminotransferase (rer070207000802) from eubacterium rectale at 1.70 a resolution
PDB Compounds: (A:) aminotransferase

SCOPe Domain Sequences for d3f0ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3f0ha_ c.67.1.0 (A:) automated matches {Eubacterium rectale}
lyfqgmlnftvgpvmsseevraigaeqvpyfrttefsstmlenekfmleyakapegskav
fmtcsstgsmeavvmncftkkdkvlvidggsfghrfvqlceiheipyvalklehgkkltk
eklyeydnqnftgllvnvdetstavlydtmmigefckknnmffvcdcvsafladpfnmne
cgadvmitgsqkvlacppgisvivlaprgvervekskvrtmyfdlkdalknqergqtpft
pavgillqinerlkeikkhggadaevariasqaadfrakikdlpfelvsespangvtsvh
pttanaydiflklkdeygiwicpnggemkdtifrvghigalthednttlvnafkdlqkrn
ll

SCOPe Domain Coordinates for d3f0ha_:

Click to download the PDB-style file with coordinates for d3f0ha_.
(The format of our PDB-style files is described here.)

Timeline for d3f0ha_: