| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) ![]() |
| Family d.108.1.0: automated matches [191308] (1 protein) not a true family |
| Protein automated matches [190038] (49 species) not a true protein |
| Species Thermoplasma acidophilum [TaxId:2303] [225555] (4 PDB entries) |
| Domain d3f0aa_: 3f0a A: [209751] automated match to d1tiqa_ complexed with aco, cl, ni |
PDB Entry: 3f0a (more details), 2.5 Å
SCOPe Domain Sequences for d3f0aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3f0aa_ d.108.1.0 (A:) automated matches {Thermoplasma acidophilum [TaxId: 2303]}
msieirklsiedletlievareswkwtyagiyseeyieswirekyskekllneivrsqsn
ldilflgafadstligfielkiiankaellrlylkpeythkkigktllleaekimkkkgi
lecrlyvhrqnsvgfsfyykngfkvedtdgsdfimekky
Timeline for d3f0aa_: