Lineage for d1ggij2 (1ggi J:113-228)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220881Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species)
  7. 221301Species Fab 50.1 (mouse), kappa L chain [48993] (3 PDB entries)
  8. 221307Domain d1ggij2: 1ggi J:113-228 [20975]
    Other proteins in same PDB: d1ggih1, d1ggij1, d1ggil1, d1ggim1

Details for d1ggij2

PDB Entry: 1ggi (more details), 2.8 Å

PDB Description: crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen

SCOP Domain Sequences for d1ggij2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggij2 b.1.1.2 (J:113-228) Immunoglobulin (constant domains of L and H chains) {Fab 50.1 (mouse), kappa L chain}
sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1ggij2:

Click to download the PDB-style file with coordinates for d1ggij2.
(The format of our PDB-style files is described here.)

Timeline for d1ggij2: