SCOPe 2.08: Domain d3eyqc1: 3eyq C:1-108

Lineage for d3eyqc1 (3eyq C:1-108)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)

8. Domain d3eyqc1: 3eyq C:1-108 [209741]
   Other proteins in same PDB: d3eyqc2
   automated match to d1rhha1

Details for d3eyqc1

PDB Entry: 3eyq, 2.4 Å

PDB Description: Crystal structure of MJ5 Fab, a germline antibody variant of anti-human cytomegalovirus antibody 8f9

PDB Compounds: (C:) M2J5 Fab

SCOPe Domain Sequences for d3eyqc1:

Sequence; same for both SEQRES and ATOM records:

>d3eyqc1 b.1.1.1 (C:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgtdftltisslepedfavyycqqrsnwppitfgqgtrleik

Timeline for d3eyqc1:

• d3eyqc1 first appeared in SCOPe 2.03
  
• d3eyqc1 appears in SCOPe 2.07