SCOPe 2.08: Domain d3eyoa2: 3eyo A:109-213

Lineage for d3eyoa2 (3eyo A:109-213)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d3eyoa2: 3eyo A:109-213 [209738]
   Other proteins in same PDB: d3eyoa1, d3eyob_, d3eyoc1, d3eyod_
   automated match to d1rhha2

Details for d3eyoa2

PDB Entry: 3eyo, 2.5 Å

PDB Description: Crystal structure of anti-human cytomegalovirus antibody 8F9

PDB Compounds: (A:) 8f9 Fab

SCOPe Domain Sequences for d3eyoa2:

Sequence; same for both SEQRES and ATOM records:

>d3eyoa2 b.1.1.2 (A:109-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d3eyoa2:

• d3eyoa2 first appeared in SCOPe 2.03
  
• d3eyoa2 appears in SCOPe 2.07