SCOPe 2.06: Domain d3eyoa1: 3eyo A:1-108

Lineage for d3eyoa1 (3eyo A:1-108)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d3eyoa1: 3eyo A:1-108 [209737]
   Other proteins in same PDB: d3eyoa2, d3eyoc2
   automated match to d1rhha1

Details for d3eyoa1

PDB Entry: 3eyo, 2.5 Å

PDB Description: Crystal structure of anti-human cytomegalovirus antibody 8F9

PDB Compounds: (A:) 8f9 Fab

SCOPe Domain Sequences for d3eyoa1:

Sequence; same for both SEQRES and ATOM records:

>d3eyoa1 b.1.1.0 (A:1-108) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvggyltwyqhkpgqaprllifdasiratgipa
rfsgsgsgtdftltitrlepedfavyycqqrsmwppvtfgqgtkleik

Timeline for d3eyoa1:

• d3eyoa1 first appeared in SCOPe 2.03
  
• d3eyoa1 appears in SCOPe 2.05
  
• d3eyoa1 appears in SCOPe 2.07
  
• d3eyoa1 appears in the current release, SCOPe 2.08