SCOPe 2.06: Domain d3ey6a1: 3ey6 A:35-150

Lineage for d3ey6a1 (3ey6 A:35-150)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (27 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225017] (10 PDB entries)

8. Domain d3ey6a1: 3ey6 A:35-150 [209731]
   Other proteins in same PDB: d3ey6a2
   automated match to d3ni6b_

Details for d3ey6a1

PDB Entry: 3ey6, 1.05 Å

PDB Description: crystal structure of the fk506-binding domain of human fkbp38

PDB Compounds: (A:) FK506-binding protein 8

SCOPe Domain Sequences for d3ey6a1:

Sequence; same for both SEQRES and ATOM records:

>d3ey6a1 d.26.1.0 (A:35-150) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ewldilgngllrkktlvpgppgssrpvkgqvvtvhlqtslengtrvqeepelvftlgdcd
viqaldlsvplmdvgetamvtadskycygpqgrspyipphaalclevtlktavdgp

Timeline for d3ey6a1:

• d3ey6a1 first appeared in SCOPe 2.03, called d3ey6a_
  
• d3ey6a1 was called d3ey6a_ in SCOPe 2.05
  
• d3ey6a1 appears in SCOPe 2.07
  
• d3ey6a1 appears in the current release, SCOPe 2.08