Lineage for d1ggih2 (1ggi H:113-228)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104016Species Fab 50.1 (mouse), kappa L chain [48993] (3 PDB entries)
  8. 104021Domain d1ggih2: 1ggi H:113-228 [20973]
    Other proteins in same PDB: d1ggih1, d1ggij1, d1ggil1, d1ggim1

Details for d1ggih2

PDB Entry: 1ggi (more details), 2.8 Å

PDB Description: crystal structure of an hiv-1 neutralizing antibody 50.1 in complex with its v3 loop peptide antigen

SCOP Domain Sequences for d1ggih2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggih2 b.1.1.2 (H:113-228) Immunoglobulin (constant domains of L and H chains) {Fab 50.1 (mouse), kappa L chain}
sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOP Domain Coordinates for d1ggih2:

Click to download the PDB-style file with coordinates for d1ggih2.
(The format of our PDB-style files is described here.)

Timeline for d1ggih2: