SCOPe 2.06: Domain d3exwb_: 3exw B:

Lineage for d3exwb_ (3exw B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
   automatically mapped to Pfam PF00541

6. Protein Adenovirus fiber protein "knob" domain [49837] (12 species)

7. Species Human adenovirus 7 [TaxId:10519] [267756] (1 PDB entry)

8. Domain d3exwb_: 3exw B: [209729]
   automated match to d3f0ya_

Details for d3exwb_

PDB Entry: 3exw, 1.75 Å

PDB Description: Crystal structure of the human Adenovirus type 7 fiber knob

PDB Compounds: (B:) L5 fiber protein

SCOPe Domain Sequences for d3exwb_:

Sequence; same for both SEQRES and ATOM records:

>d3exwb_ b.21.1.1 (B:) Adenovirus fiber protein "knob" domain {Human adenovirus 7 [TaxId: 10519]}
ddnintlwtgvnpttancqimassesndckliltlvktgalvtafvyvigvsndfnmltt
hkninftaelffdstgnlltslsslktplnhksgqnmatgaltnakgfmpsttaypfnvn
srekenyiygtcyytasdhtafpidisvmlnqralnnetsycirvtwswntgvapevqts
attlvtspftfyyiredd

Timeline for d3exwb_:

• d3exwb_ first appeared in SCOPe 2.03
  
• d3exwb_ appears in SCOPe 2.05
  
• d3exwb_ appears in SCOPe 2.07
  
• d3exwb_ appears in the current release, SCOPe 2.08