Lineage for d3exwb_ (3exw B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2048516Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
    sandwich, 10 strands in 2 sheets; greek-key
  4. 2048517Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) (S)
  5. 2048518Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins)
    automatically mapped to Pfam PF00541
  6. 2048519Protein Adenovirus fiber protein "knob" domain [49837] (12 species)
  7. 2048572Species Human adenovirus 7 [TaxId:10519] [267756] (1 PDB entry)
  8. 2048574Domain d3exwb_: 3exw B: [209729]
    automated match to d3f0ya_

Details for d3exwb_

PDB Entry: 3exw (more details), 1.75 Å

PDB Description: Crystal structure of the human Adenovirus type 7 fiber knob
PDB Compounds: (B:) L5 fiber protein

SCOPe Domain Sequences for d3exwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3exwb_ b.21.1.1 (B:) Adenovirus fiber protein "knob" domain {Human adenovirus 7 [TaxId: 10519]}
ddnintlwtgvnpttancqimassesndckliltlvktgalvtafvyvigvsndfnmltt
hkninftaelffdstgnlltslsslktplnhksgqnmatgaltnakgfmpsttaypfnvn
srekenyiygtcyytasdhtafpidisvmlnqralnnetsycirvtwswntgvapevqts
attlvtspftfyyiredd

SCOPe Domain Coordinates for d3exwb_:

Click to download the PDB-style file with coordinates for d3exwb_.
(The format of our PDB-style files is described here.)

Timeline for d3exwb_: