![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily) sandwich, 10 strands in 2 sheets; greek-key |
![]() | Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families) ![]() |
![]() | Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (2 proteins) automatically mapped to Pfam PF00541 |
![]() | Protein automated matches [190333] (6 species) not a true protein |
![]() | Species Human adenovirus 7 [TaxId:10519] [225561] (1 PDB entry) |
![]() | Domain d3exwa_: 3exw A: [209728] automated match to d3f0ya_ |
PDB Entry: 3exw (more details), 1.75 Å
SCOPe Domain Sequences for d3exwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3exwa_ b.21.1.1 (A:) automated matches {Human adenovirus 7 [TaxId: 10519]} ddnintlwtgvnpttancqimassesndckliltlvktgalvtafvyvigvsndfnmltt hkninftaelffdstgnlltslsslktplnhksgqnmatgaltnakgfmpsttaypfnvn srekenyiygtcyytasdhtafpidisvmlnqralnnetsycirvtwswntgvapevqts attlvtspftfyyiredd
Timeline for d3exwa_: