SCOPe 2.06: Domain d3exua_: 3exu A:

Lineage for d3exua_ (3exu A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (19 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries)

8. Domain d3exua_: 3exu A: [209725]
   automated match to d2b46x_
   complexed with gol, mes

Details for d3exua_

PDB Entry: 3exu, 1.81 Å

PDB Description: a glycoside hydrolase family 11 xylanase with an extended thumb region

PDB Compounds: (A:) endo-1,4-beta-xylanase

SCOPe Domain Sequences for d3exua_:

Sequence; same for both SEQRES and ATOM records:

>d3exua_ b.29.1.11 (A:) Xylanase II {Bacillus circulans [TaxId: 1397]}
astdywqnwtfgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap
ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg
ddttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss
nvtvw

Timeline for d3exua_:

• d3exua_ first appeared in SCOPe 2.03
  
• d3exua_ appears in SCOPe 2.05
  
• d3exua_ appears in SCOPe 2.07
  
• d3exua_ appears in the current release, SCOPe 2.08