Class b: All beta proteins [48724] (180 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein Xylanase II [49979] (21 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Bacillus circulans [TaxId:1397] [49980] (21 PDB entries) |
Domain d3exua_: 3exu A: [209725] automated match to d2b46x_ complexed with gol, mes |
PDB Entry: 3exu (more details), 1.81 Å
SCOPe Domain Sequences for d3exua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3exua_ b.29.1.11 (A:) Xylanase II {Bacillus circulans [TaxId: 1397]} astdywqnwtfgggivnavngsggnysvnwsntgnfvvgkgwttgspfrtinynagvwap ngngyltlygwtrsplieyyvvdswgtyrptgtykgtvksdggtydiytttrynapsidg ddttftqywsvrqskrptgsnatitfsnhvnawkshgmnlgsnwayqvmategyqssgss nvtvw
Timeline for d3exua_: