SCOPe 2.08: Domain d3exib1: 3exi B:1-185

Lineage for d3exib1 (3exi B:1-185)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226777] (6 PDB entries)

8. Domain d3exib1: 3exi B:1-185 [209723]
   Other proteins in same PDB: d3exia1, d3exia2, d3exib2
   automated match to d1umdb1
   complexed with cl, k

Details for d3exib1

PDB Entry: 3exi, 2.2 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex with the subunit-binding domain (sbd) of e2p, but sbd cannot be modeled into the electron density

PDB Compounds: (B:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d3exib1:

Sequence; same for both SEQRES and ATOM records:

>d3exib1 c.36.1.0 (B:1-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
efppe

Timeline for d3exib1:

• d3exib1 first appeared in SCOPe 2.03
  
• d3exib1 appears in SCOPe 2.07