Lineage for d3exia1 (3exi A:1-361)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2108258Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2108259Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2108723Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 protein domains)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 2108757Protein E1-beta subunit of pyruvate dehydrogenase (PP module) [89651] (1 species)
  7. 2108758Species Human (Homo sapiens) [TaxId:9606] [89652] (7 PDB entries)
  8. 2108767Domain d3exia1: 3exi A:1-361 [209722]
    Other proteins in same PDB: d3exia2, d3exib1, d3exib2
    automated match to d1ni4a_
    complexed with cl, k

Details for d3exia1

PDB Entry: 3exi (more details), 2.2 Å

PDB Description: Crystal structure of the pyruvate dehydrogenase (E1p) component of human pyruvate dehydrogenase complex with the subunit-binding domain (SBD) of E2p, but SBD cannot be modeled into the electron density
PDB Compounds: (A:) Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial

SCOPe Domain Sequences for d3exia1:

Sequence, based on SEQRES records: (download)

>d3exia1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]}
fandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiirg
fchlcdgqeaccvgleaginptdhlitafrahgftftrglsvreilaeltgrkggcakgk
ggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeayn
maalwklpcificennrygmgtsveraaastdyykrgdfipglrvdgmdilcvreatrfa
aaycrsgkgpilmelqtyryhghsmsdpgvsyrtreeiqevrsksdpimllkdrmvnsnl
asveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksv
s

Sequence, based on observed residues (ATOM records): (download)

>d3exia1 c.36.1.11 (A:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]}
fandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiirg
fchlcdgqeaccvgleaginptdhlitafrahgftftrglsvreilaeltgrkggcakgk
ggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeayn
maalwklpcificennrtdyykrgdfipglrvdgmdilcvreatrfaaaycrsgkgpilm
elqtysdpimllkdrmvnsnlasveelkeidvevrkeiedaaqfatadpeppleelgyhi
yssdppfevrganqwikfksvs

SCOPe Domain Coordinates for d3exia1:

Click to download the PDB-style file with coordinates for d3exia1.
(The format of our PDB-style files is described here.)

Timeline for d3exia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3exia2