| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
| Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins) parent family to TK and PFOR heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module |
| Protein E1-beta subunit of pyruvate dehydrogenase (PP module) [89651] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [89652] (7 PDB entries) |
| Domain d3exhg1: 3exh G:1-361 [209719] Other proteins in same PDB: d3exha2, d3exhb1, d3exhb2, d3exhc2, d3exhd1, d3exhd2, d3exhe2, d3exhf1, d3exhf2, d3exhg2, d3exhh1, d3exhh2 automated match to d1ni4a_ complexed with gol, k, mn, tpp |
PDB Entry: 3exh (more details), 2.44 Å
SCOPe Domain Sequences for d3exhg1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3exhg1 c.36.1.11 (G:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]}
fandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiirg
fchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakgk
ggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeayn
maalwklpcificennrygmgtaveraaastdyykrgdfipglrvdgmdilcvreatrfa
aaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiqevrsksdpimllkdrmvnsnl
asveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksv
s
Timeline for d3exhg1: