Lineage for d3exhg1 (3exh G:1-361)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2472772Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2472773Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2473284Family c.36.1.11: Branched-chain alpha-keto acid dehydrogenase PP module [88766] (5 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 2473318Protein E1-beta subunit of pyruvate dehydrogenase (PP module) [89651] (1 species)
  7. 2473319Species Human (Homo sapiens) [TaxId:9606] [89652] (7 PDB entries)
  8. 2473332Domain d3exhg1: 3exh G:1-361 [209719]
    Other proteins in same PDB: d3exha2, d3exhb1, d3exhb2, d3exhc2, d3exhd1, d3exhd2, d3exhe2, d3exhf1, d3exhf2, d3exhg2, d3exhh1, d3exhh2
    automated match to d1ni4a_
    complexed with gol, k, mn, tpp

Details for d3exhg1

PDB Entry: 3exh (more details), 2.44 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex
PDB Compounds: (G:) Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial

SCOPe Domain Sequences for d3exhg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3exhg1 c.36.1.11 (G:1-361) E1-beta subunit of pyruvate dehydrogenase (PP module) {Human (Homo sapiens) [TaxId: 9606]}
fandatfeikkcdlhrleegppvttvltredglkyyrmmqtvrrmelkadqlykqkiirg
fchlcdgqeaccvgleaginptdhlitayrahgftftrglsvreilaeltgrkggcakgk
ggsmhmyaknfyggngivgaqvplgagialackyngkdevcltlygdgaanqgqifeayn
maalwklpcificennrygmgtaveraaastdyykrgdfipglrvdgmdilcvreatrfa
aaycrsgkgpilmelqtyryhghsmsdpgvayrtreeiqevrsksdpimllkdrmvnsnl
asveelkeidvevrkeiedaaqfatadpeppleelgyhiyssdppfevrganqwikfksv
s

SCOPe Domain Coordinates for d3exhg1:

Click to download the PDB-style file with coordinates for d3exhg1.
(The format of our PDB-style files is described here.)

Timeline for d3exhg1: