SCOPe 2.07: Domain d3exhf1: 3exh F:1-185

Lineage for d3exhf1 (3exh F:1-185)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226777] (6 PDB entries)

8. Domain d3exhf1: 3exh F:1-185 [209717]
   Other proteins in same PDB: d3exha1, d3exha2, d3exhb2, d3exhc1, d3exhc2, d3exhd2, d3exhe1, d3exhe2, d3exhf2, d3exhg1, d3exhg2, d3exhh2
   automated match to d1umdb1
   complexed with gol, k, mn, tpp

Details for d3exhf1

PDB Entry: 3exh, 2.44 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex

PDB Compounds: (F:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d3exhf1:

Sequence; same for both SEQRES and ATOM records:

>d3exhf1 c.36.1.0 (F:1-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
efppe

Timeline for d3exhf1:

• d3exhf1 first appeared in SCOPe 2.03
  
• d3exhf1 appears in SCOPe 2.06