![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.0: automated matches [227300] (1 protein) not a true family |
![]() | Protein automated matches [227126] (21 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [226777] (6 PDB entries) |
![]() | Domain d3exhd1: 3exh D:1-185 [209714] Other proteins in same PDB: d3exha1, d3exha2, d3exhb2, d3exhc1, d3exhc2, d3exhd2, d3exhe1, d3exhe2, d3exhf2, d3exhg1, d3exhg2, d3exhh2 automated match to d1umdb1 complexed with gol, k, mn, tpp |
PDB Entry: 3exh (more details), 2.44 Å
SCOPe Domain Sequences for d3exhd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3exhd1 c.36.1.0 (D:1-185) automated matches {Human (Homo sapiens) [TaxId: 9606]} lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf efppe
Timeline for d3exhd1: