Lineage for d3exhd1 (3exh D:1-185)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2864564Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 2864565Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 2865204Family c.36.1.0: automated matches [227300] (1 protein)
    not a true family
  6. 2865205Protein automated matches [227126] (21 species)
    not a true protein
  7. 2865304Species Human (Homo sapiens) [TaxId:9606] [226777] (6 PDB entries)
  8. 2865313Domain d3exhd1: 3exh D:1-185 [209714]
    Other proteins in same PDB: d3exha1, d3exha2, d3exhb2, d3exhc1, d3exhc2, d3exhd2, d3exhe1, d3exhe2, d3exhf2, d3exhg1, d3exhg2, d3exhh2
    automated match to d1umdb1
    complexed with gol, k, mn, tpp

Details for d3exhd1

PDB Entry: 3exh (more details), 2.44 Å

PDB Description: crystal structure of the pyruvate dehydrogenase (e1p) component of human pyruvate dehydrogenase complex
PDB Compounds: (D:) Pyruvate dehydrogenase E1 component subunit beta, mitochondrial

SCOPe Domain Sequences for d3exhd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3exhd1 c.36.1.0 (D:1-185) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lqvtvrdainqgmdeelerdekvfllgeevaqydgaykvsrglwkkygdkriidtpisem
gfagiavgaamaglrpicefmtfnfsmqaidqvinsaaktyymsgglqpvpivfrgpnga
sagvaaqhsqcfaawyghcpglkvvspwnsedakgliksairdnnpvvvlenelmygvpf
efppe

SCOPe Domain Coordinates for d3exhd1:

Click to download the PDB-style file with coordinates for d3exhd1.
(The format of our PDB-style files is described here.)

Timeline for d3exhd1: