Lineage for d1ggbh2 (1ggb H:113-228)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2747669Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species)
  7. 2747968Species Mouse (Mus musculus) [TaxId:10090] [88576] (391 PDB entries)
    Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form
  8. 2748215Domain d1ggbh2: 1ggb H:113-228 [20971]
    Other proteins in same PDB: d1ggbh1, d1ggbh3, d1ggbl1, d1ggbl2
    part of Fab 50.1

Details for d1ggbh2

PDB Entry: 1ggb (more details), 2.8 Å

PDB Description: major antigen-induced domain rearrangements in an antibody
PDB Compounds: (H:) igg2a-kappa 50.1 fab (heavy chain)

SCOPe Domain Sequences for d1ggbh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ggbh2 b.1.1.2 (H:113-228) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
sakttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqs
dlytlsssvtvtsstwpsqsitcnvahpasstkvdkkiepr

SCOPe Domain Coordinates for d1ggbh2:

Click to download the PDB-style file with coordinates for d1ggbh2.
(The format of our PDB-style files is described here.)

Timeline for d1ggbh2: